SCOPe 2.08: Domain d2ojzh_: 2ojz H:

Lineage for d2ojzh_ (2ojz H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2ojzh_: 2ojz H: [139120]
   Other proteins in same PDB: d2ojzl1, d2ojzl2, d2ojzm1, d2ojzm2
   automated match to d6shgh_

Details for d2ojzh_

PDB Entry: 2ojz, 2.73 Å

PDB Description: Anti-DNA antibody ED10

PDB Compounds: (H:) Fab ED10 heavy chain

SCOPe Domain Sequences for d2ojzh_:

Sequence; same for both SEQRES and ATOM records:

>d2ojzh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqleesgpelvkpgasvkisckasgytftdyymnwlrqkpgqglewigwvypgsikyne
kfkdkatltadtsssivymhlssltsddnavyfctrwtygssfdywgegtlltvssaktt
ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d2ojzh_:

• d2ojzh_ first appeared in SCOP 1.73, called d2ojzh1
  
• d2ojzh_ was called d2ojzh1 in SCOPe 2.07