Lineage for d2ojzh_ (2ojz H:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. Domain d2ojzh_: 2ojz H: [139120]
    Other proteins in same PDB: d2ojzl1, d2ojzl2, d2ojzm1, d2ojzm2
    automated match to d6shgh_

Details for d2ojzh_

PDB Entry: 2ojz (more details), 2.73 Å

PDB Description: Anti-DNA antibody ED10
PDB Compounds: (H:) Fab ED10 heavy chain

SCOPe Domain Sequences for d2ojzh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ojzh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqleesgpelvkpgasvkisckasgytftdyymnwlrqkpgqglewigwvypgsikyne
kfkdkatltadtsssivymhlssltsddnavyfctrwtygssfdywgegtlltvssaktt
ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d2ojzh_ are not available.

Timeline for d2ojzh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ojzi_, d2ojzl1, d2ojzl2, d2ojzm1, d2ojzm2