Lineage for d2ojtb1 (2ojt B:5-116,B:119-252)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 710786Protein Glutamate receptor ligand binding core [53881] (4 species)
  7. 710905Species Rat (Rattus norvegicus), GluR5 [TaxId:10116] [142802] (6 PDB entries)
  8. 710911Domain d2ojtb1: 2ojt B:5-116,B:119-252 [139117]
    automatically matched to 1TXF A:5-116,A:119-252
    complexed with 1pe, br, uba; mutant

Details for d2ojtb1

PDB Entry: 2ojt (more details), 1.95 Å

PDB Description: structure and mechanism of kainate receptor modulation by anions
PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 1

SCOP Domain Sequences for d2ojtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ojtb1 c.94.1.1 (B:5-116,B:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]}
tlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkygaq
ndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkXpidsadd
lakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvlttdy
allmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegklhm
mkekwwr

SCOP Domain Coordinates for d2ojtb1:

Click to download the PDB-style file with coordinates for d2ojtb1.
(The format of our PDB-style files is described here.)

Timeline for d2ojtb1: