SCOP 1.73: Domain d2ojta1: 2ojt A:5-116,A:119-252

Lineage for d2ojta1 (2ojt A:5-116,A:119-252)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (4 species)

7. Species Rat (Rattus norvegicus), GluR5 [TaxId:10116] [142802] (6 PDB entries)

8. Domain d2ojta1: 2ojt A:5-116,A:119-252 [139116]
   automatically matched to 1TXF A:5-116,A:119-252
   complexed with 1pe, br, uba; mutant

Details for d2ojta1

PDB Entry: 2ojt, 1.95 Å

PDB Description: structure and mechanism of kainate receptor modulation by anions

PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 1

SCOP Domain Sequences for d2ojta1:

Sequence; same for both SEQRES and ATOM records:

>d2ojta1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]}
tlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkygaq
ndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkXpidsadd
lakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvlttdy
allmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegklhm
mkekwwr

Timeline for d2ojta1:

• d2ojta1 is new in SCOP 1.73
  
• d2ojta1 last appears in SCOP 1.75