Lineage for d2odkb_ (2odk B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1688830Fold d.306: YefM-like [143119] (1 superfamily)
    core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet;
  4. 1688831Superfamily d.306.1: YefM-like [143120] (2 families) (S)
  5. 1688832Family d.306.1.1: YefM-like [143121] (2 proteins)
    antitoxin component of the YefM/YoeB-like system; binds to the toxin component wia extra C-terminal tail, unstructured in the free state, but adopting a RelB-like conformation in the bound state
    automatically mapped to Pfam PF02604
  6. 1688839Protein Hypothetical protein NE2111 [143124] (1 species)
  7. 1688840Species Nitrosomonas europaea [TaxId:915] [143125] (1 PDB entry)
    Uniprot Q82T22 1-51
  8. 1688842Domain d2odkb_: 2odk B: [139031]
    automated match to d2odka1
    complexed with gol, so4

Details for d2odkb_

PDB Entry: 2odk (more details), 1.4 Å

PDB Description: Putative prevent-host-death protein from Nitrosomonas europaea
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2odkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2odkb_ d.306.1.1 (B:) Hypothetical protein NE2111 {Nitrosomonas europaea [TaxId: 915]}
hvwpvqdakarfsefldacitegpqivsrrgaeeavlvpigewrrlqaaa

SCOPe Domain Coordinates for d2odkb_:

Click to download the PDB-style file with coordinates for d2odkb_.
(The format of our PDB-style files is described here.)

Timeline for d2odkb_: