SCOP 1.73: Domain d2odkb1: 2odk B:2-51

Lineage for d2odkb1 (2odk B:2-51)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.306: YefM-like [143119] (1 superfamily)
   core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet;

4. Superfamily d.306.1: YefM-like [143120] (1 family)

5. Family d.306.1.1: YefM-like [143121] (2 proteins)
   antitoxin component of the YefM/YoeB-like system; binds to the toxin component wia extra C-terminal tail, unstructured in the free state, but adopting a RelB-like conformation in the bound state

6. Protein Hypothetical protein NE2111 [143124] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [143125] (1 PDB entry)

8. Domain d2odkb1: 2odk B:2-51 [139031]
   automatically matched to 2ODK A:1-51
   complexed with gol, so4

Details for d2odkb1

PDB Entry: 2odk, 1.4 Å

PDB Description: Putative prevent-host-death protein from Nitrosomonas europaea

PDB Compounds: (B:) hypothetical protein

SCOP Domain Sequences for d2odkb1:

Sequence; same for both SEQRES and ATOM records:

>d2odkb1 d.306.1.1 (B:2-51) Hypothetical protein NE2111 {Nitrosomonas europaea [TaxId: 915]}
hvwpvqdakarfsefldacitegpqivsrrgaeeavlvpigewrrlqaaa

Timeline for d2odkb1:

• d2odkb1 is new in SCOP 1.73
  
• d2odkb1 appears in SCOP 1.75
  
• d2odkb1 appears in the current release, SCOPe 2.08, called d2odkb_