Lineage for d2oauf3 (2oau F:27-112)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028151Fold f.34: Mechanosensitive channel protein MscS (YggB), transmembrane region [82860] (1 superfamily)
    oligomeric fold; 3 transmembrane helices per subunit
  4. 3028152Superfamily f.34.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82861] (1 family) (S)
  5. 3028153Family f.34.1.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82862] (1 protein)
  6. 3028154Protein Mechanosensitive channel protein MscS (YggB), transmembrane region [82863] (1 species)
    homoheptameric protein
  7. 3028155Species Escherichia coli [TaxId:562] [82864] (2 PDB entries)
  8. 3028168Domain d2oauf3: 2oau F:27-112 [138995]
    Other proteins in same PDB: d2oaua1, d2oaua2, d2oaub1, d2oaub2, d2oauc1, d2oauc2, d2oaud1, d2oaud2, d2oaue1, d2oaue2, d2oauf1, d2oauf2, d2oaug1, d2oaug2
    automatically matched to d1mxma3

Details for d2oauf3

PDB Entry: 2oau (more details), 3.7 Å

PDB Description: Mechanosensitive Channel of Small Conductance (MscS)
PDB Compounds: (F:) Small-conductance mechanosensitive channel

SCOPe Domain Sequences for d2oauf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oauf3 f.34.1.1 (F:27-112) Mechanosensitive channel protein MscS (YggB), transmembrane region {Escherichia coli [TaxId: 562]}
yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal
grvgvqtasviavlgaaglavglalq

SCOPe Domain Coordinates for d2oauf3:

Click to download the PDB-style file with coordinates for d2oauf3.
(The format of our PDB-style files is described here.)

Timeline for d2oauf3: