![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.43: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82689] (1 family) ![]() the last strand of the fold is flipped away and involved in oligomerisation |
![]() | Family d.58.43.1: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82690] (1 protein) |
![]() | Protein Mechanosensitive channel protein MscS (YggB), C-terminal domain [82691] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [82692] (2 PDB entries) |
![]() | Domain d2oauc2: 2oau C:180-280 [138985] Other proteins in same PDB: d2oaua1, d2oaua3, d2oaub1, d2oaub3, d2oauc1, d2oauc3, d2oaud1, d2oaud3, d2oaue1, d2oaue3, d2oauf1, d2oauf3, d2oaug1, d2oaug3 automatically matched to d1mxma2 |
PDB Entry: 2oau (more details), 3.7 Å
SCOPe Domain Sequences for d2oauc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oauc2 d.58.43.1 (C:180-280) Mechanosensitive channel protein MscS (YggB), C-terminal domain {Escherichia coli [TaxId: 562]} repvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrv wsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv
Timeline for d2oauc2: