SCOPe 2.08: Domain d2nz9c1: 2nz9 C:2-111

Lineage for d2nz9c1 (2nz9 C:2-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)

8. Domain d2nz9c1: 2nz9 C:2-111 [138840]
   Other proteins in same PDB: d2nz9c2, d2nz9d1, d2nz9d2, d2nz9d3, d2nz9e2, d2nz9f1, d2nz9f2, d2nz9f3
   automatically matched to d1egjl1
   complexed with ca, zn

Details for d2nz9c1

PDB Entry: 2nz9, 3.79 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody ar2

PDB Compounds: (C:) AR2 monoclonal antibody

SCOPe Domain Sequences for d2nz9c1:

Sequence; same for both SEQRES and ATOM records:

>d2nz9c1 b.1.1.1 (C:2-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
ivltqspatlslspgeratiscrasesvdsyghsfmqwyqqkpgqaprlliyrasnlepg
iparfsgsgsgtdftltisslepedfavyycqqgnevpftfgqgtkveik

Timeline for d2nz9c1:

• d2nz9c1 first appeared in SCOP 1.73
  
• d2nz9c1 appears in SCOPe 2.07