Lineage for d2nz9f1 (2nz9 F:6-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739734Species Engineered (including hybrid species) [88562] (67 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 2739822Domain d2nz9f1: 2nz9 F:6-118 [138846]
    Other proteins in same PDB: d2nz9c1, d2nz9c2, d2nz9d2, d2nz9d3, d2nz9e1, d2nz9e2, d2nz9f2, d2nz9f3
    automatically matched to d1mhph1
    complexed with ca, zn

Details for d2nz9f1

PDB Entry: 2nz9 (more details), 3.79 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody ar2
PDB Compounds: (F:) AR2 monoclonal antibody

SCOPe Domain Sequences for d2nz9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nz9f1 b.1.1.1 (F:6-118) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
esggglvqpggslrlscaasgftfsdhymywvrqapgkglewvatisdggsytyysdsve
grfttsrdnskntlylqmnslraedtaiyycsryryddamdywgqgtlvtvss

SCOPe Domain Coordinates for d2nz9f1:

Click to download the PDB-style file with coordinates for d2nz9f1.
(The format of our PDB-style files is described here.)

Timeline for d2nz9f1: