![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD4 C2-set domains [49149] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries) |
![]() | Domain d2nxzb2: 2nxz B:1098-1181 [138752] Other proteins in same PDB: d2nxza1, d2nxzb1, d2nxzc1, d2nxzc2, d2nxzd1, d2nxzd2 complexed with edo, hez, ipa, nag |
PDB Entry: 2nxz (more details), 2.04 Å
SCOPe Domain Sequences for d2nxzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nxzb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvlafqk
Timeline for d2nxzb2: