Lineage for d2nxzc1 (2nxz C:2001-2111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740853Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)
  8. 2740864Domain d2nxzc1: 2nxz C:2001-2111 [138753]
    Other proteins in same PDB: d2nxza1, d2nxzb1, d2nxzb2, d2nxzc2, d2nxzd1, d2nxzd2
    automated match to d1rz8a1
    complexed with edo, hez, ipa, nag

Details for d2nxzc1

PDB Entry: 2nxz (more details), 2.04 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (t257s, s334a, s375w) complexed with cd4 and antibody 17b
PDB Compounds: (C:) antibody 17b, light chain

SCOPe Domain Sequences for d2nxzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxzc1 b.1.1.1 (C:2001-2111) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleikrt

SCOPe Domain Coordinates for d2nxzc1:

Click to download the PDB-style file with coordinates for d2nxzc1.
(The format of our PDB-style files is described here.)

Timeline for d2nxzc1: