SCOP 1.73: Domain d2nvte1: 2nvt E:2-143

Lineage for d2nvte1 (2nvt E:2-143)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)

6. Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries)

8. Domain d2nvte1: 2nvt E:2-143 [138651]
   Other proteins in same PDB: d2nvta1, d2nvtb1, d2nvtc1, d2nvtc2, d2nvte2, d2nvtf1, d2nvth1, d2nvti1, d2nvti2, d2nvtj1, d2nvtk1, d2nvtl1
   automatically matched to d1i3qe1
   complexed with g2p, mg, zn

Details for d2nvte1

PDB Entry: 2nvt, 3.36 Å

PDB Description: RNA Polymerase II Elongation Complex in 150 mM Mg+2 with GMPCPP

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d2nvte1:

Sequence; same for both SEQRES and ATOM records:

>d2nvte1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

Timeline for d2nvte1:

• d2nvte1 is new in SCOP 1.73
  
• d2nvte1 appears in SCOP 1.75
  
• d2nvte1 appears in the current release, SCOPe 2.08