| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily) core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family) ![]() |
| Family d.78.1.1: RPB5 [55288] (2 proteins) |
| Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries) |
| Domain d2nvte2: 2nvt E:144-215 [138652] Other proteins in same PDB: d2nvta1, d2nvtb1, d2nvtc1, d2nvtc2, d2nvte1, d2nvtf1, d2nvth1, d2nvti1, d2nvti2, d2nvtj1, d2nvtk1, d2nvtl1 automatically matched to d1dzfa2 complexed with g2p, mg, zn |
PDB Entry: 2nvt (more details), 3.36 Å
SCOP Domain Sequences for d2nvte2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvte2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm
Timeline for d2nvte2: