SCOP 1.73: Domain d2nvti2: 2nvt I:50-120

Lineage for d2nvti2 (2nvt I:50-120)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)

8. Domain d2nvti2: 2nvt I:50-120 [138656]
   Other proteins in same PDB: d2nvta1, d2nvtb1, d2nvtc1, d2nvtc2, d2nvte1, d2nvte2, d2nvtf1, d2nvth1, d2nvtj1, d2nvtk1, d2nvtl1
   automatically matched to d1i3qi2
   complexed with g2p, mg, zn

Details for d2nvti2

PDB Entry: 2nvt, 3.36 Å

PDB Description: RNA Polymerase II Elongation Complex in 150 mM Mg+2 with GMPCPP

PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOP Domain Sequences for d2nvti2:

Sequence; same for both SEQRES and ATOM records:

>d2nvti2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq

Timeline for d2nvti2:

• d2nvti2 is new in SCOP 1.73
  
• d2nvti2 appears in SCOP 1.75
  
• d2nvti2 appears in the current release, SCOPe 2.08