Lineage for d2nvqa1 (2nvq A:3-1445)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1057387Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1057388Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1057461Family e.29.1.2: RNA-polymerase beta-prime [64490] (2 proteins)
  6. 1057462Protein RBP1 [64486] (1 species)
  7. 1057463Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64487] (24 PDB entries)
    Uniprot P04050; part of multichain biological unit
  8. 1057468Domain d2nvqa1: 2nvq A:3-1445 [138634]
    Other proteins in same PDB: d2nvqb_, d2nvqc1, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqf1, d2nvqh_, d2nvqi1, d2nvqi2, d2nvqj_, d2nvqk_, d2nvql1
    automatically matched to d1i50a_
    protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvqa1

PDB Entry: 2nvq (more details), 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOPe Domain Sequences for d2nvqa1:

Sequence, based on SEQRES records: (download)

>d2nvqa1 e.29.1.2 (A:3-1445) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsid
rnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelm
rqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglklv
gswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvp
pppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhvat
ymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleld
qvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskrag
diqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadf
dgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfie
ldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkd
ngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngf
stgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrfl
neardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdr
tlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlv
kaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdll
ntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirr
iiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccll
rsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtln
tfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaiehtt
lksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraam
ndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlkk
ientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpgi
dptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqgglt
svtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgafd
vmi

Sequence, based on observed residues (ATOM records): (download)

>d2nvqa1 e.29.1.2 (A:3-1445) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsid
rnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelm
rqalaikdskkrfaaiwtlcktkmvcetdvpslvsrggcgntqptirkdglklvgswklr
vlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrpsisfnesqrged
dltfkladilkanisletlehngaphhaieeaesllqfhvatymdndiagqpqalqksgr
pvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleldqvgvpksiaktltypevv
tpynidrltqlvrngpnehpgakyvirdsgdridlryskragdiqlqygwkverhimdnd
pvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgdemnlhvpqseetrae
lsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldqvlnmlywvpdwdgvi
ptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkdngmliidgqiifgvvekk
tvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstgigdtiadgptmreit
etiaeakkkvldvtkeaqanlltakhgmtlresfednvvrflneardkagrlaevnlkdl
nnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlphfskddyspeskgfv
ensylrgltpqefffhamggreglidtavktaetgyiqrrlvkaledimvhydnttrnsl
gnviqfiygedgmdaahiekqsldtiggsdaafekryrvdllntdhtldpsllesgseil
gdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiqnaqqtfhidhtkpsd
ltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsrlatrrvlqeyrltkq
afdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlntfhfagvaskkvtsgvpr
lkeilnvaknmktpsltvylepghaadqeqaklirsaiehttlksvtiaseiyydpdprs
tvipedeeiiqlhfslqqspwllrleldraamndkdltmgqvgerikqtfkndlfviwse
dndekliircrvvaeedhmlkkientmlenitlrgveniervvmmkydrkvpsptgeyvk
epewvletdgvnlsevmtvpgidptriytnsfidimevlgieagraalykevynviasdg
syvnyrhmallvdvmttqggltsvtrhgfnrsntgalmrcsfeetveilfeagasaeldd
crgvsenvilgqmapigtgafdvmi

SCOPe Domain Coordinates for d2nvqa1:

Click to download the PDB-style file with coordinates for d2nvqa1.
(The format of our PDB-style files is described here.)

Timeline for d2nvqa1: