Lineage for d2nvqc1 (2nvq C:3-37,C:173-268)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031575Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1031673Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 1031674Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 1031727Protein RPB3 [64315] (1 species)
  7. 1031728Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 1031733Domain d2nvqc1: 2nvq C:3-37,C:173-268 [138636]
    Other proteins in same PDB: d2nvqa1, d2nvqb_, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqf1, d2nvqh_, d2nvqi1, d2nvqi2, d2nvqj_, d2nvqk_, d2nvql1
    automatically matched to d1i3qc1
    protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvqc1

PDB Entry: 2nvq (more details), 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2nvqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvqc1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd

SCOPe Domain Coordinates for d2nvqc1:

Click to download the PDB-style file with coordinates for d2nvqc1.
(The format of our PDB-style files is described here.)

Timeline for d2nvqc1: