Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein automated matches [190169] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188399] (33 PDB entries) |
Domain d2nvca_: 2nvc A: [138628] automated match to d1pwla_ complexed with ita, nap |
PDB Entry: 2nvc (more details), 1.65 Å
SCOPe Domain Sequences for d2nvca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvca_ c.1.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} asrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqe klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa vnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakh nkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcal lsctshkdypfheef
Timeline for d2nvca_: