Lineage for d2nu1e_ (2nu1 E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318224Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 1318416Protein automated matches [190306] (4 species)
    not a true protein
  7. 1318435Species Streptomyces griseus [TaxId:1911] [187119] (8 PDB entries)
  8. 1318442Domain d2nu1e_: 2nu1 E: [138598]
    Other proteins in same PDB: d2nu1i1
    automated match to d1sgde_

Details for d2nu1e_

PDB Entry: 2nu1 (more details), 1.8 Å

PDB Description: molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i and tyr18i
PDB Compounds: (E:) Streptogrisin B

SCOPe Domain Sequences for d2nu1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu1e_ b.47.1.1 (E:) automated matches {Streptomyces griseus [TaxId: 1911]}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

SCOPe Domain Coordinates for d2nu1e_:

Click to download the PDB-style file with coordinates for d2nu1e_.
(The format of our PDB-style files is described here.)

Timeline for d2nu1e_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nu1i1