Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.2: Archaeal IMP cyclohydrolase PurO [75569] (1 family) has a putative active site in the same topological location as the Ntn hydrolase but lacks the N-terminal nucleophile automatically mapped to Pfam PF07826 |
Family d.153.2.1: Archaeal IMP cyclohydrolase PurO [75570] (1 protein) Pfam PF07826 |
Protein Hypothetical protein MTH1020 [75571] (1 species) |
Species Methanothermobacter thermautotrophicus [TaxId:145262] [75572] (4 PDB entries) |
Domain d2ntkb_: 2ntk B: [138584] Other proteins in same PDB: d2ntka3 complexed with imp |
PDB Entry: 2ntk (more details), 2.03 Å
SCOPe Domain Sequences for d2ntkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ntkb_ d.153.2.1 (B:) Hypothetical protein MTH1020 {Methanothermobacter thermautotrophicus [TaxId: 145262]} mylgrilavgrnsngsfvayrvssrsfpnrttsiqeervavvpvegherdvfrnpyiayn cirivgdtavvsngshtdtiadkvalgmnlrdaiglsllamdyekdelntpriaaaings eafigivtadglmvsrvpeetpvyistyeqtepaatefkagspeeaaefilkggefaaft hpvtaaaafndgegwnlatrem
Timeline for d2ntkb_:
View in 3D Domains from other chains: (mouse over for more information) d2ntka2, d2ntka3, d2ntkc_, d2ntkd_ |