SCOPe 2.04: Domain d2nrsa3: 2nrs A:178-326

Lineage for d2nrsa3 (2nrs A:178-326)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
   automatically mapped to Pfam PF00994

6. Protein MoeA, central domain [64104] (4 species)

7. Species Escherichia coli [TaxId:562] [64105] (14 PDB entries)

8. Domain d2nrsa3: 2nrs A:178-326 [138541]
   Other proteins in same PDB: d2nrsa1, d2nrsa2, d2nrsb1, d2nrsb2
   automated match to d1g8la3

Details for d2nrsa3

PDB Entry: 2nrs, 2.8 Å

PDB Description: moea s371w

PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nrsa3:

Sequence; same for both SEQRES and ATOM records:

>d2nrsa3 c.57.1.2 (A:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf
ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl
pgnpvsatltfyqlvqpllaklsgntasg

Timeline for d2nrsa3:

• d2nrsa3 first appeared in SCOP 1.73
  
• d2nrsa3 appears in SCOPe 2.03
  
• d2nrsa3 appears in SCOPe 2.05
  
• d2nrsa3 appears in the current release, SCOPe 2.08