Lineage for d2nrsa1 (2nrs A:327-409)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560503Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1561038Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) (S)
    automatically mapped to Pfam PF03454
  5. 1561039Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 1561047Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 1561048Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)
  8. 1561075Domain d2nrsa1: 2nrs A:327-409 [138539]
    Other proteins in same PDB: d2nrsa2, d2nrsa3, d2nrsb2, d2nrsb3
    automated match to d1g8la1

Details for d2nrsa1

PDB Entry: 2nrs (more details), 2.8 Å

PDB Description: moea s371w
PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nrsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrsa1 b.85.6.1 (A:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgwhifssfslgncfivl
erdrgnvevgewvevepfnalfg

SCOPe Domain Coordinates for d2nrsa1:

Click to download the PDB-style file with coordinates for d2nrsa1.
(The format of our PDB-style files is described here.)

Timeline for d2nrsa1: