SCOPe 2.08: Domain d2nr9a1: 2nr9 A:4-192

Lineage for d2nr9a1 (2nr9 A:4-192)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.51: Rhomboid-like [144090] (1 superfamily)
   6 transmembrane helices

4. Superfamily f.51.1: Rhomboid-like [144091] (2 families)

5. Family f.51.1.1: Rhomboid-like [144092] (3 proteins)
   Pfam PF01694; transmembrane serine protease

6. Protein GlpG homolog HI0618 [144093] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [144094] (1 PDB entry)
   Uniprot P44783 4-192

8. Domain d2nr9a1: 2nr9 A:4-192 [138519]
   Other proteins in same PDB: d2nr9a2
   complexed with pa6, pqe

Details for d2nr9a1

PDB Entry: 2nr9, 2.2 Å

PDB Description: crystal structure of glpg, rhomboid peptidase from haemophilus influenzae

PDB Compounds: (A:) Protein glpG homolog

SCOPe Domain Sequences for d2nr9a1:

Sequence; same for both SEQRES and ATOM records:

>d2nr9a1 f.51.1.1 (A:4-192) GlpG homolog HI0618 {Haemophilus influenzae [TaxId: 727]}
flaqqgkitliltalcvliyiaqqlgfeddimylmhypayeeqdsevwryishtlvhlsn
lhilfnlswffifggmiertfgsvkllmlyvvasaitgyvqnyvsgpaffglsgvvyavl
gyvfirdklnhhlfdlpegfftmllvgialgfisplfgvemgnaahisglivgliwgfid
sklrknsle

Timeline for d2nr9a1:

• d2nr9a1 first appeared in SCOP 1.73
  
• d2nr9a1 appears in SCOPe 2.07