PDB entry 2nr9

View 2nr9 on RCSB PDB site
Description: Crystal structure of GlpG, Rhomboid Peptidase from Haemophilus influenzae
Class: membrane protein
Keywords: intramembrane peptidase, rhomboid protease, membrane protein
Deposited on 2006-11-01, released 2006-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.236
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein glpG homolog
    Species: Haemophilus influenzae [TaxId:281310]
    Gene: glpG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44783 (Start-191)
      • engineered (23)
      • cloning artifact (192-194)
    Domains in SCOPe 2.08: d2nr9a1, d2nr9a2
  • Heterogens: PA6, PQE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nr9A (A:)
    menflaqqgkitliltalcvliyiaqqlgfeddimylmhypayeeqdsevwryishtlvh
    lsnlhilfnlswffifggmiertfgsvkllmlyvvasaitgyvqnyvsgpaffglsgvvy
    avlgyvfirdklnhhlfdlpegfftmllvgialgfisplfgvemgnaahisglivgliwg
    fidsklrknslelvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nr9A (A:)
    flaqqgkitliltalcvliyiaqqlgfeddimylmhypayeeqdsevwryishtlvhlsn
    lhilfnlswffifggmiertfgsvkllmlyvvasaitgyvqnyvsgpaffglsgvvyavl
    gyvfirdklnhhlfdlpegfftmllvgialgfisplfgvemgnaahisglivgliwgfid
    sklrknslelvp