Class b: All beta proteins [48724] (174 folds) |
Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) |
Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins) |
Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species) |
Species Escherichia coli [TaxId:562] [63885] (14 PDB entries) |
Domain d2nqsb2: 2nqs B:7-177 [138500] Other proteins in same PDB: d2nqsa1, d2nqsa3, d2nqsb1, d2nqsb3 automatically matched to d1fc5a2 complexed with gol |
PDB Entry: 2nqs (more details), 2.5 Å
SCOPe Domain Sequences for d2nqsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqsb2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]} lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk
Timeline for d2nqsb2: