SCOP 1.73: Domain d2nqsb2: 2nqs B:7-177

Lineage for d2nqsb2 (2nqs B:7-177)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
   complex fold made of bifurcated and coiled b-sheets

4. Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family)

5. Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)

7. Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)

8. Domain d2nqsb2: 2nqs B:7-177 [138500]
   Other proteins in same PDB: d2nqsa1, d2nqsa3, d2nqsb1, d2nqsb3
   automatically matched to d1fc5a2
   complexed with gol; mutant

Details for d2nqsb2

PDB Entry: 2nqs, 2.5 Å

PDB Description: moea e188a

PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOP Domain Sequences for d2nqsb2:

Sequence; same for both SEQRES and ATOM records:

>d2nqsb2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

Timeline for d2nqsb2:

• d2nqsb2 is new in SCOP 1.73
  
• d2nqsb2 appears in SCOP 1.75
  
• d2nqsb2 appears in the current release, SCOPe 2.08