![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) ![]() automatically mapped to Pfam PF03454 |
![]() | Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins) |
![]() | Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [63870] (14 PDB entries) |
![]() | Domain d2nqsb1: 2nqs B:327-409 [138499] Other proteins in same PDB: d2nqsa2, d2nqsa3, d2nqsb2, d2nqsb3 automatically matched to d1g8la1 complexed with gol |
PDB Entry: 2nqs (more details), 2.5 Å
SCOPe Domain Sequences for d2nqsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqsb1 b.85.6.1 (B:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]} lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl erdrgnvevgewvevepfnalfg
Timeline for d2nqsb1: