Lineage for d2nqsa2 (2nqs A:7-177)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1333899Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 1333900Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 1333901Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)
  6. 1333909Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 1333910Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)
  8. 1333923Domain d2nqsa2: 2nqs A:7-177 [138497]
    Other proteins in same PDB: d2nqsa1, d2nqsa3, d2nqsb1, d2nqsb3
    automatically matched to d1fc5a2
    complexed with gol

Details for d2nqsa2

PDB Entry: 2nqs (more details), 2.5 Å

PDB Description: moea e188a
PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nqsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqsa2 b.103.1.1 (A:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOPe Domain Coordinates for d2nqsa2:

Click to download the PDB-style file with coordinates for d2nqsa2.
(The format of our PDB-style files is described here.)

Timeline for d2nqsa2: