| Class b: All beta proteins [48724] (165 folds) |
| Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) ![]() |
| Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins) |
| Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species) |
| Species Escherichia coli [TaxId:562] [63885] (14 PDB entries) |
| Domain d2nqsa2: 2nqs A:7-177 [138497] Other proteins in same PDB: d2nqsa1, d2nqsa3, d2nqsb1, d2nqsb3 automatically matched to d1fc5a2 complexed with gol; mutant |
PDB Entry: 2nqs (more details), 2.5 Å
SCOP Domain Sequences for d2nqsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqsa2 b.103.1.1 (A:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk
Timeline for d2nqsa2: