SCOP 1.73: Domain d2nqsb1: 2nqs B:327-409

Lineage for d2nqsb1 (2nqs B:327-409)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family)

5. Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)

7. Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)

8. Domain d2nqsb1: 2nqs B:327-409 [138499]
   Other proteins in same PDB: d2nqsa2, d2nqsa3, d2nqsb2, d2nqsb3
   automatically matched to d1g8la1
   complexed with gol; mutant

Details for d2nqsb1

PDB Entry: 2nqs, 2.5 Å

PDB Description: moea e188a

PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOP Domain Sequences for d2nqsb1:

Sequence; same for both SEQRES and ATOM records:

>d2nqsb1 b.85.6.1 (B:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalfg

Timeline for d2nqsb1:

• d2nqsb1 is new in SCOP 1.73
  
• d2nqsb1 appears in SCOP 1.75
  
• d2nqsb1 appears in the current release, SCOPe 2.08