Lineage for d2nqga_ (2nqg A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2173726Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
    automatically mapped to Pfam PF00648
  6. 2173727Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species)
    includes the N-terminal 'sequence' domain I
  7. 2173745Species Norway rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (10 PDB entries)
    Uniprot P97571 33-353
  8. 2173751Domain d2nqga_: 2nqg A: [138453]
    automated match to d1tloa_
    complexed with ca, nqg

Details for d2nqga_

PDB Entry: 2nqg (more details), 2.04 Å

PDB Description: calpain 1 proteolytic core inactivated by wr18(s,s), an epoxysuccinyl- type inhibitor.
PDB Compounds: (A:) Calpain-1 catalytic subunit

SCOPe Domain Sequences for d2nqga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqga_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]}
naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq
lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse
afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh
aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg
efwmsfrdfireftkleicnlt

SCOPe Domain Coordinates for d2nqga_:

Click to download the PDB-style file with coordinates for d2nqga_.
(The format of our PDB-style files is described here.)

Timeline for d2nqga_: