Lineage for d2jm5a1 (2jm5 A:3-134)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1092942Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1092943Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1092944Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 1092974Protein Regulator of G-protein signaling 18, RGS18 [140750] (1 species)
  7. 1092975Species Human (Homo sapiens) [TaxId:9606] [140751] (1 PDB entry)
    Uniprot Q9NS28 75-206
  8. 1092976Domain d2jm5a1: 2jm5 A:3-134 [138355]

Details for d2jm5a1

PDB Entry: 2jm5 (more details)

PDB Description: solution structure of the rgs domain from human rgs18
PDB Compounds: (A:) Regulator of G-protein signaling 18

SCOPe Domain Sequences for d2jm5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jm5a1 a.91.1.1 (A:3-134) Regulator of G-protein signaling 18, RGS18 {Human (Homo sapiens) [TaxId: 9606]}
vspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqihlk
akaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrflk
sdiyldlmegrp

SCOPe Domain Coordinates for d2jm5a1:

Click to download the PDB-style file with coordinates for d2jm5a1.
(The format of our PDB-style files is described here.)

Timeline for d2jm5a1: