![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
![]() | Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (1 family) ![]() |
![]() | Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (8 proteins) |
![]() | Protein Regulator of G-protein signaling 18, RGS18 [140750] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140751] (1 PDB entry) |
![]() | Domain d2jm5a1: 2jm5 A:3-134 [138355] |
PDB Entry: 2jm5 (more details)
SCOP Domain Sequences for d2jm5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jm5a1 a.91.1.1 (A:3-134) Regulator of G-protein signaling 18, RGS18 {Human (Homo sapiens) [TaxId: 9606]} vspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqihlk akaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrflk sdiyldlmegrp
Timeline for d2jm5a1: