Lineage for d2ji3c1 (2ji3 C:39-126)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299231Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 1299232Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
    binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
    automatically mapped to Pfam PF01880
  6. 1299233Protein Desulfoferrodoxin C-terminal domain [49371] (2 species)
  7. 1299234Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [110068] (6 PDB entries)
    Uniprot Q46495
  8. 1299251Domain d2ji3c1: 2ji3 C:39-126 [138351]
    Other proteins in same PDB: d2ji3a2, d2ji3b2, d2ji3c2, d2ji3d2
    automatically matched to d1dfx_1
    complexed with ca, fe, no3, per; mutant

Details for d2ji3c1

PDB Entry: 2ji3 (more details), 1.95 Å

PDB Description: x-ray structure of the iron-peroxide intermediate of superoxide reductase (e114a mutant) from desulfoarculus baarsii
PDB Compounds: (C:) desulfoferrodoxin

SCOPe Domain Sequences for d2ji3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji3c1 b.1.13.1 (C:39-126) Desulfoferrodoxin C-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
entvdaakekhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgqa
peavflieaakvvaraycnihghwkaen

SCOPe Domain Coordinates for d2ji3c1:

Click to download the PDB-style file with coordinates for d2ji3c1.
(The format of our PDB-style files is described here.)

Timeline for d2ji3c1: