SCOPe 2.03: Domain d2ji3d1: 2ji3 D:39-126

Lineage for d2ji3d1 (2ji3 D:39-126)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (2 families)

5. Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
   binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
   automatically mapped to Pfam PF01880

6. Protein Desulfoferrodoxin C-terminal domain [49371] (2 species)

7. Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [110068] (6 PDB entries)
   Uniprot Q46495

8. Domain d2ji3d1: 2ji3 D:39-126 [138353]
   Other proteins in same PDB: d2ji3a2, d2ji3b2, d2ji3c2, d2ji3d2
   automatically matched to d1dfx_1
   complexed with ca, fe, no3, per; mutant

Details for d2ji3d1

PDB Entry: 2ji3, 1.95 Å

PDB Description: x-ray structure of the iron-peroxide intermediate of superoxide reductase (e114a mutant) from desulfoarculus baarsii

PDB Compounds: (D:) desulfoferrodoxin

SCOPe Domain Sequences for d2ji3d1:

Sequence; same for both SEQRES and ATOM records:

>d2ji3d1 b.1.13.1 (D:39-126) Desulfoferrodoxin C-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
entvdaakekhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgqa
peavflieaakvvaraycnihghwkaen

Timeline for d2ji3d1:

• d2ji3d1 first appeared in SCOP 1.73
  
• d2ji3d1 appears in SCOPe 2.02
  
• d2ji3d1 appears in SCOPe 2.04
  
• d2ji3d1 appears in the current release, SCOPe 2.08