| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) ![]() |
| Family c.59.1.0: automated matches [254241] (1 protein) not a true family |
| Protein automated matches [254550] (3 species) not a true protein |
| Species Escherichia coli [TaxId:562] [255259] (8 PDB entries) |
| Domain d2jfha2: 2jfh A:298-440 [138310] Other proteins in same PDB: d2jfha1, d2jfha3 automated match to d2jfga2 complexed with lk1, so4 |
PDB Entry: 2jfh (more details), 1.97 Å
SCOPe Domain Sequences for d2jfha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfha2 c.59.1.0 (A:298-440) automated matches {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelgshh
Timeline for d2jfha2: