SCOPe 2.05: Domain d2jfha2: 2jfh A:298-440

Lineage for d2jfha2 (2jfh A:298-440)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families)

5. Family c.59.1.0: automated matches [254241] (1 protein)
   not a true family

6. Protein automated matches [254550] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255259] (8 PDB entries)

8. Domain d2jfha2: 2jfh A:298-440 [138310]
   Other proteins in same PDB: d2jfha1, d2jfha3
   automated match to d2jfga2
   complexed with lk1, so4

Details for d2jfha2

PDB Entry: 2jfh, 1.97 Å

PDB Description: crystal structure of murd ligase in complex with l-glu containing sulfonamide inhibitor

PDB Compounds: (A:) udp-n-acetylmuramoyl-alanine-d-glutamate ligase

SCOPe Domain Sequences for d2jfha2:

Sequence; same for both SEQRES and ATOM records:

>d2jfha2 c.59.1.0 (A:298-440) automated matches {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelgshh

Timeline for d2jfha2:

• d2jfha2 first appeared in SCOP 1.73
  
• d2jfha2 appears in SCOPe 2.04
  
• d2jfha2 appears in SCOPe 2.06
  
• d2jfha2 appears in the current release, SCOPe 2.08