Lineage for d2jfga2 (2jfg A:298-437)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1174742Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 1174743Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 1174744Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. 1174761Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species)
  7. 1174762Species Escherichia coli [TaxId:562] [53247] (11 PDB entries)
  8. 1174763Domain d2jfga2: 2jfg A:298-437 [138307]
    Other proteins in same PDB: d2jfga1, d2jfga3
    automatically matched to d1e0da2
    complexed with adp, so4, uma

Details for d2jfga2

PDB Entry: 2jfg (more details), 1.52 Å

PDB Description: crystal structure of murd ligase in complex with uma and adp
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2jfga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfga2 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

SCOPe Domain Coordinates for d2jfga2:

Click to download the PDB-style file with coordinates for d2jfga2.
(The format of our PDB-style files is described here.)

Timeline for d2jfga2: