Lineage for d2jffa1 (2jff A:1-93)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1582799Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 1582800Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 1582822Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. 1582823Protein automated matches [254548] (3 species)
    not a true protein
  7. 1582824Species Escherichia coli [TaxId:562] [255257] (8 PDB entries)
  8. 1582827Domain d2jffa1: 2jff A:1-93 [138303]
    Other proteins in same PDB: d2jffa2, d2jffa3
    automated match to d2jfga1
    complexed with lk2, so4

Details for d2jffa1

PDB Entry: 2jff (more details), 1.89 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2jffa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jffa1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOPe Domain Coordinates for d2jffa1:

Click to download the PDB-style file with coordinates for d2jffa1.
(The format of our PDB-style files is described here.)

Timeline for d2jffa1: