Lineage for d2jffa1 (2jff A:1-93)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689508Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 689509Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family) (S)
  5. 689510Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 689523Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species)
  7. 689524Species Escherichia coli [TaxId:562] [51987] (9 PDB entries)
  8. 689529Domain d2jffa1: 2jff A:1-93 [138303]
    Other proteins in same PDB: d2jffa2, d2jffa3
    automatically matched to d1e0da1
    complexed with lk2, so4

Details for d2jffa1

PDB Entry: 2jff (more details), 1.89 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOP Domain Sequences for d2jffa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jffa1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOP Domain Coordinates for d2jffa1:

Click to download the PDB-style file with coordinates for d2jffa1.
(The format of our PDB-style files is described here.)

Timeline for d2jffa1: