![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
![]() | Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (26 PDB entries) |
![]() | Domain d2jfcf1: 2jfc F:2-159 [138301] automatically matched to d1gs6x1 complexed with cl, cu; mutant |
PDB Entry: 2jfc (more details), 2.4 Å
SCOP Domain Sequences for d2jfcf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfcf1 b.6.1.3 (F:2-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad rsgtfvyhcapegmvpwhvvsglsgtlmvlprdglkdp
Timeline for d2jfcf1: