Lineage for d2jfcd2 (2jfc D:160-336)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660887Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 661004Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 661165Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (26 PDB entries)
  8. 661235Domain d2jfcd2: 2jfc D:160-336 [138298]
    automatically matched to d1gs6x2
    complexed with cl, cu; mutant

Details for d2jfcd2

PDB Entry: 2jfc (more details), 2.4 Å

PDB Description: m144l mutant of nitrite reductase from alcaligenes xylosoxidans in space group p212121
PDB Compounds: (D:) dissimilatory copper-containing nitrite reductase

SCOP Domain Sequences for d2jfcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfcd2 b.6.1.3 (D:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr

SCOP Domain Coordinates for d2jfcd2:

Click to download the PDB-style file with coordinates for d2jfcd2.
(The format of our PDB-style files is described here.)

Timeline for d2jfcd2: