PDB entry 2jfc

View 2jfc on RCSB PDB site
Description: m144l mutant of nitrite reductase from alcaligenes xylosoxidans in space group p212121
Class: oxidoreductase
Keywords: electron transfer. nitrite reductase, denitrification, complex formation, mutant, copper, metal-binding, oxidoreductase, alcaligenes xylosoxidans
Deposited on 2007-01-31, released 2007-05-29
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-29, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.172
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ALCALIGENES XYLOSOXYDANS XYLOSOXYDANS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601 (0-334)
      • engineered mutation (142)
    Domains in SCOP 1.73: d2jfca1, d2jfca2
  • Chain 'B':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ALCALIGENES XYLOSOXYDANS XYLOSOXYDANS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601 (0-334)
      • engineered mutation (142)
    Domains in SCOP 1.73: d2jfcb1, d2jfcb2
  • Chain 'C':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ALCALIGENES XYLOSOXYDANS XYLOSOXYDANS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601 (0-334)
      • engineered mutation (142)
    Domains in SCOP 1.73: d2jfcc1, d2jfcc2
  • Chain 'D':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ALCALIGENES XYLOSOXYDANS XYLOSOXYDANS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601 (0-334)
      • engineered mutation (142)
    Domains in SCOP 1.73: d2jfcd1, d2jfcd2
  • Chain 'E':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ALCALIGENES XYLOSOXYDANS XYLOSOXYDANS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601 (0-334)
      • engineered mutation (142)
    Domains in SCOP 1.73: d2jfce1, d2jfce2
  • Chain 'F':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ALCALIGENES XYLOSOXYDANS XYLOSOXYDANS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601 (0-334)
      • engineered mutation (142)
    Domains in SCOP 1.73: d2jfcf1, d2jfcf2
  • Heterogens: CU, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jfcA (A:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsglsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaaghikvegkwnddlmkqikapapipr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jfcB (B:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsglsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaaghikvegkwnddlmkqikapapipr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jfcC (C:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsglsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaaghikvegkwnddlmkqikapapipr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jfcD (D:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsglsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaaghikvegkwnddlmkqikapapipr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jfcE (E:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsglsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaaghikvegkwnddlmkqikapapipr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jfcF (F:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsglsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaaghikvegkwnddlmkqikapapipr