Lineage for d2jevb2 (2jev B:3-170)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533562Protein automated matches [190241] (13 species)
    not a true protein
  7. 2533591Species Human (Homo sapiens) [TaxId:9606] [187321] (11 PDB entries)
  8. 2533598Domain d2jevb2: 2jev B:3-170 [138288]
    Other proteins in same PDB: d2jeva3, d2jevb3
    automated match to d2b3ua1
    complexed with nhq

Details for d2jevb2

PDB Entry: 2jev (more details), 2.3 Å

PDB Description: crystal structure of human spermine,spermidine acetyltransferase in complex with a bisubstrate analog (n1-acetylspermine-s-coa).
PDB Compounds: (B:) Diamine acetyltransferase 1

SCOPe Domain Sequences for d2jevb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jevb2 d.108.1.1 (B:3-170) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke
hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc
ssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate

SCOPe Domain Coordinates for d2jevb2:

Click to download the PDB-style file with coordinates for d2jevb2.
(The format of our PDB-style files is described here.)

Timeline for d2jevb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jevb3