PDB entry 2jev

View 2jev on RCSB PDB site
Description: crystal structure of human spermine,spermidine acetyltransferase in complex with a bisubstrate analog (n1-acetylspermine-s-coa).
Class: transferase
Keywords: acyltransferase, acetyltransferase, gcn5 related n-acetyltransferase, polyamine biosynthesis, gnat, spermine, spermidine, transferase, bisubstrate
Deposited on 2007-01-23, released 2007-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jeva2, d2jeva3
  • Chain 'B':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jevb2, d2jevb3
  • Heterogens: NHQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jevA (A:)
    gshmakfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclva
    evpkehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqva
    mrcrcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jevA (A:)
    akfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpk
    ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr
    cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jevB (B:)
    gshmakfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclva
    evpkehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqva
    mrcrcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jevB (B:)
    akfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpk
    ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr
    cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate