Lineage for d2jefa1 (2jef A:241-342)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008507Family d.240.1.0: automated matches [231323] (1 protein)
    not a true family
  6. 3008508Protein automated matches [231324] (5 species)
    not a true protein
  7. 3008530Species Sulfolobus solfataricus [TaxId:273057] [231327] (33 PDB entries)
  8. 3008543Domain d2jefa1: 2jef A:241-342 [138278]
    Other proteins in same PDB: d2jefa2, d2jefa3
    automated match to d2v4ra2
    protein/DNA complex; complexed with ca, dgt

Details for d2jefa1

PDB Entry: 2jef (more details), 2.17 Å

PDB Description: the molecular basis of selectivity of nucleotide triphosphate incorporation opposite o6-benzylguanine by sulfolobus solfataricus dna polymerase iv: steady-state and pre-steady-state and x-ray crystallography of correct and incorrect pairing
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2jefa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jefa1 d.240.1.0 (A:241-342) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfie

SCOPe Domain Coordinates for d2jefa1:

Click to download the PDB-style file with coordinates for d2jefa1.
(The format of our PDB-style files is described here.)

Timeline for d2jefa1: