Lineage for d2jaka1 (2jak A:30-372)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006830Family a.118.1.20: B56-like [140819] (1 protein)
    Pfam PF01603; Protein phosphatase 2A regulatory B subunit family
  6. 2006831Protein Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma [140820] (1 species)
  7. 2006832Species Human (Homo sapiens) [TaxId:9606] [140821] (5 PDB entries)
    Uniprot Q13362 30-372! Uniprot Q13362 38-425
  8. 2006833Domain d2jaka1: 2jak A:30-372 [138240]

Details for d2jaka1

PDB Entry: 2jak (more details), 2.6 Å

PDB Description: human pp2a regulatory subunit b56g
PDB Compounds: (A:) serine/threonine-protein phosphatase 2a 56 kda regulatory subunit gamma isoform

SCOPe Domain Sequences for d2jaka1:

Sequence, based on SEQRES records: (download)

>d2jaka1 a.118.1.20 (A:30-372) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]}
irdvppadqeklfiqklrqccvlfdfvsdplsdlkwkevkraalsemveyithnrnvite
piypevvhmfavnmfrtlppssnptgaefdpeedeptleaawphlqlvyefflrflespd
fqpniakkyidqkfvlqllelfdsedprerdflkttlhriygkflglrayirkqinnify
rfiyetehhngiaelleilgsiingfalplkeehkifllkvllplhkvkslsvyhpqlay
cvvqflekdstltepvvmallkywpkthspkevmflneleeildviepsefvkimeplfr
qlakcvssphfqvaeralyywnneyimslisdnaakilpimfp

Sequence, based on observed residues (ATOM records): (download)

>d2jaka1 a.118.1.20 (A:30-372) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]}
irdvpadqeklfiqklrqccvlfdfvsdplsdlkwkevkraalsemveyithnrnvitep
iypevvhmfavnmfrtlppptleaawphlqlvyefflrflespdfqpniakkyidqkfvl
qllelfdsedprerdflkttlhriygkflglrayirkqinnifyrfiyetehhngiaell
eilgsiingfalplkeehkifllkvllplhkvkslsvyhpqlaycvvqflekdstltepv
vmallkywpkthspkevmflneleeildviepsefvkimeplfrqlakcvssphfqvaer
alyywnneyimslisdnaakilpimfp

SCOPe Domain Coordinates for d2jaka1:

Click to download the PDB-style file with coordinates for d2jaka1.
(The format of our PDB-style files is described here.)

Timeline for d2jaka1: