Lineage for d2ja8i2 (2ja8 I:50-117)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 892996Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 892997Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)
  6. 892998Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
    contains two differently decorated domains of this fold
  7. 893001Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
    Uniprot P27999; part of multichain biological unit
  8. 893039Domain d2ja8i2: 2ja8 I:50-117 [138234]
    Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c1, d2ja8c2, d2ja8d1, d2ja8e1, d2ja8e2, d2ja8f1, d2ja8g1, d2ja8g2, d2ja8h1, d2ja8j1, d2ja8k1, d2ja8l1
    automatically matched to d1i3qi2
    complexed with bru, mg, tt, zn

Details for d2ja8i2

PDB Entry: 2ja8 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex d
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOP Domain Sequences for d2ja8i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja8i2 g.41.3.1 (I:50-117) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknk

SCOP Domain Coordinates for d2ja8i2:

Click to download the PDB-style file with coordinates for d2ja8i2.
(The format of our PDB-style files is described here.)

Timeline for d2ja8i2: