Lineage for d2ja8c2 (2ja8 C:42-172)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879236Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 879237Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 879238Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 879291Protein RPB3 [64462] (1 species)
  7. 879292Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 879311Domain d2ja8c2: 2ja8 C:42-172 [138225]
    Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c1, d2ja8d1, d2ja8e1, d2ja8e2, d2ja8f1, d2ja8g1, d2ja8g2, d2ja8h1, d2ja8i1, d2ja8i2, d2ja8j1, d2ja8k1, d2ja8l1
    automatically matched to d1i3qc2
    complexed with bru, mg, tt, zn

Details for d2ja8c2

PDB Entry: 2ja8 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex d
PDB Compounds: (C:) DNA-directed RNA polymerase II 45kda polypeptide

SCOP Domain Sequences for d2ja8c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja8c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOP Domain Coordinates for d2ja8c2:

Click to download the PDB-style file with coordinates for d2ja8c2.
(The format of our PDB-style files is described here.)

Timeline for d2ja8c2: