SCOP 1.73: Domain d2ja7f1: 2ja7 F:72-155

Lineage for d2ja7f1 (2ja7 F:72-155)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.2: RPB6 [55294] (1 protein)

6. Protein RPB6 [55295] (2 species)
   essential subunit of RNA polymerases I, II and III

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (24 PDB entries)

8. Domain d2ja7f1: 2ja7 F:72-155 [138197]
   Other proteins in same PDB: d2ja7a1, d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7g1, d2ja7g2, d2ja7h1, d2ja7i1, d2ja7i2, d2ja7j1, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7s1, d2ja7s2, d2ja7t1, d2ja7u1, d2ja7u2, d2ja7v1, d2ja7w1, d2ja7x1
   automatically matched to d1i3qf_
   complexed with bru, mg, tt, zn

Details for d2ja7f1

PDB Entry: 2ja7, 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex c

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOP Domain Sequences for d2ja7f1:

Sequence; same for both SEQRES and ATOM records:

>d2ja7f1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

Timeline for d2ja7f1:

• d2ja7f1 is new in SCOP 1.73
  
• d2ja7f1 appears in SCOP 1.75
  
• d2ja7f1 appears in the current release, SCOPe 2.08