SCOP 1.73: Domain d2ja7i1: 2ja7 I:2-49

Lineage for d2ja7i1 (2ja7 I:2-49)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)

8. Domain d2ja7i1: 2ja7 I:2-49 [138201]
   Other proteins in same PDB: d2ja7a1, d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7f1, d2ja7g1, d2ja7g2, d2ja7h1, d2ja7j1, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7r1, d2ja7s1, d2ja7s2, d2ja7t1, d2ja7v1, d2ja7w1, d2ja7x1
   automatically matched to d1i3qi1
   complexed with bru, mg, tt, zn

Details for d2ja7i1

PDB Entry: 2ja7, 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex c

PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOP Domain Sequences for d2ja7i1:

Sequence; same for both SEQRES and ATOM records:

>d2ja7i1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

Timeline for d2ja7i1:

• d2ja7i1 is new in SCOP 1.73
  
• d2ja7i1 appears in SCOP 1.75
  
• d2ja7i1 appears in the current release, SCOPe 2.08